Protein Info for HP15_1229 in Marinobacter adhaerens HP15

Annotation: translation initiation factor, aIF-2BI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 17 to 342 (326 residues), 450.4 bits, E=3.5e-139
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 47 to 342 (296 residues), 361.2 bits, E=4.1e-112
• PF01008: IF-2B
  • amino acids 57 to 341 (285 residues), 266 bits, E=1.8e-83

Best Hits

Swiss-Prot: 80% identical to MTNA_MARHV: Methylthioribose-1-phosphate isomerase (mtnA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 80% identity to maq:Maqu_2493)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• L-methionine salvage cycle III (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (5/7 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• L-methionine salvage cycle I (bacteria and plants) (8/12 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle II (plants) (6/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

See E4PHM8 at UniProt or InterPro

Protein Sequence (354 amino acids)

>HP15_1229 translation initiation factor, aIF-2BI family (Marinobacter adhaerens HP15)
MTTTPKPSQERAIGTVAIRWHGSSLELLDQRLLPGEEHWITLEGAAGVAQSIRDMVVRGA
PAIGISAAYGVALAARHAGGGDWKAEIKQAIRELAASRPTAVNLFWALQRMERIFHACHS
LDEAVKRLASEARAIHEEDLAANFAMADHALEFIGAEAPFSVLTHCNTGALATGGYGTAL
GVVRRLYEEKLLADVYADETRPWLQGGRLTAWELSRDGIPVTLNADGAAAAIMARKDVRW
VIVGADRITANGDVVNKIGTYSLAVLARHHKVGFMVVAPSSTVDMATASGADVAIEERDG
IEIREIRGIGLAPEGINVFNPVFDVTPASLIDAIVTEKGVVHNPNITGMQALFG