Protein Info for Psest_0125 in Pseudomonas stutzeri RCH2

Annotation: type VI secretion ATPase, ClpV1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 transmembrane" amino acids 765 to 782 (18 residues), see Phobius details TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 851 (839 residues), 1156.6 bits, see alignment E=0 PF02861: Clp_N" amino acids 17 to 122 (106 residues), 30.6 bits, see alignment E=2e-10 PF23569: NBD_SMAX1" amino acids 191 to 273 (83 residues), 29.8 bits, see alignment E=3e-10 PF00004: AAA" amino acids 208 to 339 (132 residues), 35.8 bits, see alignment E=5.7e-12 amino acids 602 to 719 (118 residues), 30.2 bits, see alignment E=3.2e-10 PF17871: AAA_lid_9" amino acids 347 to 437 (91 residues), 99.1 bits, see alignment E=6.9e-32 PF07724: AAA_2" amino acids 597 to 762 (166 residues), 191.6 bits, see alignment E=6e-60 PF07728: AAA_5" amino acids 601 to 721 (121 residues), 37.2 bits, see alignment E=1.6e-12 PF10431: ClpB_D2-small" amino acids 773 to 840 (68 residues), 33.9 bits, see alignment 1.5e-11

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 87% identity to pmy:Pmen_0097)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDC3 at UniProt or InterPro

Protein Sequence (863 amino acids)

>Psest_0125 type VI secretion ATPase, ClpV1 family (Pseudomonas stutzeri RCH2)
MINVDLQQLVQALDAETKRDLEGAAERCVVRGGSKILVEDLLLGLLERSDGLLKRALLDA
EVDAGALAQALQPRGEHSESRNPVFSTELVQWLQDALLVASLELGQSQIDQAALILALLR
NPLRYAGSHYQPLLARLDAERLRDFALSQQPQGSTGKPAAGGESNLARFTHNFTQQARDG
KLDPVLCRDSAIRQMIDILARRRKNNPIVVGEAGVGKTAIVEGLALRIASGEVPATLKGV
ELLCLDLGLLQAGASVKGEFERRLQGVIDEVKASPKPIILFIDEAHTLIGAGGQAGSGDA
ANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPSVQEAVTILRGLAP
VYEKSHGIYLRDDAVAAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEALERL
RGEVAEGERQREAMRRDLAVGLPVDAAALERLEQRLIAAGDEIEQLETRWAKQRLLAERL
LDLRKRTAEARSAANEDGEVPSLDELETELRAVQAELAAAQAKQRLVSHEVCPRLVAEVI
SHWTGVPLAQLAREHNAQVANFAADLRARVRGQEQAVEALDRAMRAAAAGLNKPDAPVGV
FLLVGPSGVGKTETALALADLLYGGERFLTVINMSEFQEKHSVSRLIGAPPGYVGYGEGG
MLTEAVRQKPYSVILLDEVEKADPDVMNVFYQIFDKGVANDGEGREINFRNTLILMTSNL
ASERIASFCTAGQRPTAEDLELAIRPQLSQHFKPALLGRMRVVPYYPIAGAVLDELVALK
LVRFGERLQRRQLQFSHCPALVTHLSERCDDSDSGARLIDHLIEQHLQPLVVDRLLDAMA
SGEPLQQVHATLNGDGALVCEFA