Protein Info for PGA1_c12650 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): D-lactate transporter, permease component 1
Rationale: Specific phenotype on D-lactate and D,L-lactate and cofit with other components
Original annotation: putative high-affinity branched-chain amino acid transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 323 (278 residues), 134.3 bits, see alignment E=2.4e-43

Best Hits

KEGG orthology group: None (inferred from 83% identity to sit:TM1040_1513)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW25 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PGA1_c12650 D-lactate transporter, permease component 1 (Phaeobacter inhibens DSM 17395)
MFTLNKKDKTLLLVVAILTLFAPFILNPFPTGSALAQFNAGYPDLMQRFVIFGIFAIGFN
ILFGLTGYLSFGHAAFLGVGSYSAVWMFKLLSMNVVPAIVLSVIVAGLFALVIGYVSLRR
SGIYFSILTLAFAQMSFNLAYSVLTPITNGETGLQLTLDDPRVLGVSATADGSIPVTSLF
GLEMRSTFEMVVGPWAFQFNAGYYLCALILLAAFYLSIRIFRSPFGLMLKAVKSNQQRMN
YTGLNTRPYTLAAFVISGMYAGLAGGLMASMDPLAGAERMQWTASGEVVLMTILGGAGTL
IGPVLGAGFIKYFENIFSKINDNVLHSWFSFMPDGIEDAMVFIVHPFIGKGWHLTLGILF
MLVVIFLPGGLVEGGQKLRGWIQGRKAKKDGPSGKTEPAE