Protein Info for PGA1_c12620 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator, araC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR00229: PAS domain S-box protein" amino acids 5 to 112 (108 residues), 34.6 bits, see alignment E=9.4e-13 PF13188: PAS_8" amino acids 5 to 53 (49 residues), 26 bits, see alignment E=1.3e-09 PF13426: PAS_9" amino acids 11 to 112 (102 residues), 38.1 bits, see alignment E=3.2e-13 PF00196: GerE" amino acids 118 to 170 (53 residues), 50 bits, see alignment E=3.6e-17

Best Hits

KEGG orthology group: None (inferred from 70% identity to sit:TM1040_1516)

Predicted SEED Role

"Transcriptional regulator, LuxR family/sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZT1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>PGA1_c12620 putative transcriptional regulator, araC family (Phaeobacter inhibens DSM 17395)
MTDLAFEFAPVGIALLDQRVIQRCNRQFAETFGGESSSYVGLPIAELYPSREDFQRIGDR
LQQPDAQSGHYNDERIMRRRNGDLFWCRVRGRSLTPEHHFRSGVWSFADISDDRPVVSLT
PRERDVAILTCRGLSAKEIGAELNLSYRTIETHRAHLLVKFSARKLPELVAKLTGMPL