Protein Info for PGA1_c12610 in Phaeobacter inhibens DSM 17395

Annotation: biotin carboxyl carrier protein of acetyl-CoA carboxylase AccB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 9 to 165 (157 residues), 131.8 bits, E=1.5e-42
• PF00364: Biotin_lipoyl
  • amino acids 92 to 164 (73 residues), 86.9 bits, E=6.5e-29

Best Hits

Swiss-Prot: 49% identical to BCCP_HAEIN: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 78% identity to sit:TM1040_1517)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)

Sequence Analysis Tools

See I7EL61 at UniProt or InterPro

Protein Sequence (165 amino acids)

>PGA1_c12610 biotin carboxyl carrier protein of acetyl-CoA carboxylase AccB (Phaeobacter inhibens DSM 17395)
MTNKTHEADVSFIKALAELLRDNDLTELQVKRDYGEDDSLNVRVSRQTIAAPAPVQAYAA
PAPVAAAPAAPAAPAAAPAAANDDPASHPGAVPSPMVGTVYTQPEPGAPTFVKVGDQVAE
GDTLLIVEAMKTMNHIPAPKAGTIKRILVEDGAAVEFGTPLAIIE