Protein Info for PGA1_c12520 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent Clp protease proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00574: CLP_protease" amino acids 22 to 201 (180 residues), 275.7 bits, see alignment E=9.2e-87

Best Hits

Swiss-Prot: 94% identical to CLPP_RUEST: ATP-dependent Clp protease proteolytic subunit (clpP) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 94% identity to sit:TM1040_1527)

MetaCyc: 66% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZS3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PGA1_c12520 ATP-dependent Clp protease proteolytic subunit (Phaeobacter inhibens DSM 17395)
MVDPRETYMNTLVPMVVEQTSRGERAYDIFSRLLKERIIFLNGPVHDGMSSLIVAQLLHL
EAENPSKEISMYINSPGGVVTSGLSIYDTMQYIKPKVSTLVIGQAASMGSLLLTAGEAGM
RFSLPNSRVMVHQPSGGFQGQATDIMIHAEETLKLKKRLNEIYVKHTGQEYDKIVDALER
DNFMSPEDAKDFGLIDEIVENRSKLDDQDS