Protein Info for Psest_1266 in Pseudomonas stutzeri RCH2

Annotation: ribosome-associated GTPase EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 458 (456 residues), 576.2 bits, see alignment E=7.4e-177 TIGR00231: small GTP-binding protein domain" amino acids 4 to 153 (150 residues), 72.8 bits, see alignment E=4.2e-24 amino acids 202 to 369 (168 residues), 82.7 bits, see alignment E=3.8e-27 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 106.3 bits, see alignment E=5e-34 amino acids 204 to 322 (119 residues), 95.1 bits, see alignment E=1.6e-30 PF02421: FeoB_N" amino acids 5 to 125 (121 residues), 53.2 bits, see alignment E=1.3e-17 amino acids 203 to 366 (164 residues), 52.7 bits, see alignment E=1.8e-17 PF00009: GTP_EFTU" amino acids 203 to 370 (168 residues), 37.8 bits, see alignment E=7.6e-13 PF14714: KH_dom-like" amino acids 378 to 458 (81 residues), 91.8 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 96% identical to DER_PSEU5: GTPase Der (der) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03977, GTP-binding protein (inferred from 96% identity to psa:PST_3027)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKH9 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Psest_1266 ribosome-associated GTPase EngA (Pseudomonas stutzeri RCH2)
MVPVIALVGRPNVGKSTLFNRLTKSRDAIVAEYAGLTRDRQYGEAKWQGRTYIVIDTGGI
SGDEEGIDAKMAEQSLQAIEEADAVLFMVDARAGMTAADQMIGEHLRKRNKRCFLVANKV
DSVDPDIARAEFSPLGLGDALPIAAAHGRGISHMLEEALGIFPKDNAEDAEGDDAAELID
GEEVVAEGQEPKRIPGPSEKDGIKIAIIGRPNVGKSTLVNRMLGEERVIVYDQAGTTRDS
IYIPFERDDEKYTLIDTAGVRRRGKIFEAVEKFSVVKTLQAIQDANVVIFVMDAREGVVE
HDLNLLGFVLETGRALVIALNKWDGMEPGERDYVKTELERRLFFVDFADIHFISAKHGTG
VGHLYKSVQAAFKSAITRWPTSRLTQILEDAVREHAPPMVASRRIKLRYAHLGGANPPLI
VIHGNQVDSIPKSYTRYLENTYRRVLKLVGTPIRIEYKGGENPYEGKKNTLTDRQVNKKR
RLMSHHKKAEKKRRDKR