Protein Info for Psest_1262 in Pseudomonas stutzeri RCH2

Annotation: 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 92% identical to ISPG_AZOVD: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 92% identity to avn:Avin_40290)

MetaCyc: 73% identical to (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) (Escherichia coli K-12 substr. MG1655)
RXN-15878 [EC: 1.17.7.3]

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
taxadiene biosynthesis (engineered) (12/13 steps found)
methylerythritol phosphate pathway I (9/9 steps found)
methylerythritol phosphate pathway II (9/9 steps found)
isoprene biosynthesis I (9/10 steps found)
superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1 or 1.17.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK98 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_1262 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (Pseudomonas stutzeri RCH2)
MHSESPIKRRQSRKIWVGSVPVGGDAPISVQSMTNTETCDVEATVAQIQRLANAGADIVR
VSVPSMEAAEAFGRIKRLVQLPLVADIHFDYQIALRVAELGVDCLRINPGNIGREDRVRA
VVDAARDKGIPIRIGVNAGSLEKDLQKKYGEPTPQALVESALRHVDHLDRLDFQDFKVSV
KASDVFMAVEAYRLLAGQIEQPLHLGITEAGGLRSGTVKSAVGLGMLLADGIGDTIRVSL
AADPVEEIKVGFDILKSLRLRSRGINFIACPSCSRQNFDVVKTMNELEARVEDLLVPMDV
AVIGCVVNGPGEAKEAHVGLTGGSPNNLVYIDGKPAQKLNNENLVDELEQLIRRKAAEKL
ASDAAVIARS