Protein Info for Psest_1261 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 113 to 133 (21 residues), see Phobius details PF13560: HTH_31" amino acids 17 to 79 (63 residues), 31.5 bits, see alignment E=3.7e-11 PF13413: HTH_25" amino acids 19 to 78 (60 residues), 78.6 bits, see alignment E=5e-26 PF13464: RodZ_C" amino acids 262 to 333 (72 residues), 85.4 bits, see alignment E=4.1e-28

Best Hits

KEGG orthology group: None (inferred from 80% identity to psa:PST_3032)

Predicted SEED Role

"FIG021952: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKH4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psest_1261 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MTAPHQESAAPTGNNPGETLRKAREDKGWTLSAVAQQLNLTERSLGRIEAGDFSQLPGHT
FARGYVRAYAKLLGLDQTRLVQEFDQHTGTNASGSNVNSLGRIEEPGRLSRTFMRFFGFA
LLLLLAAVAWYWWQERAEREATRSPVSVLERIEVEGADGTTEIHLLDRTDEVAEPAIEAQ
PEQGAPIAESDASETDETLEGNAEPSDSSSPAAESQQSQPLALPETASESAVVSAQAPAL
ATPAPASDSVAPAPVPGEAQLELRFTADCWTRVSDADGRVLFSALAKAGTSRTVSGKAPL
DVHLGFARGAQLSYNGEAVNLASHMRGETARLKLGQ