Protein Info for PGA1_c12440 in Phaeobacter inhibens DSM 17395

Annotation: sulphur oxidation protein SoxZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF08770: SoxZ" amino acids 10 to 103 (94 residues), 105.1 bits, see alignment E=6.5e-35 TIGR04490: thiosulfate oxidation carrier complex protein SoxZ" amino acids 13 to 106 (94 residues), 107 bits, see alignment E=1.9e-35

Best Hits

KEGG orthology group: None (inferred from 88% identity to sil:SPO0995)

MetaCyc: 71% identical to SoxZ (Paracoccus pantotrophus)

Predicted SEED Role

"Sulfur oxidation protein SoxZ" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DPH0 at UniProt or InterPro

Protein Sequence (109 amino acids)

>PGA1_c12440 sulphur oxidation protein SoxZ (Phaeobacter inhibens DSM 17395)
MASGVKPRVKVPKKATAGEAVTIKTLISHKMESGQRKDKEGNVIPRSIINRFTCEFNGES
VVDVTMEPAISTNPYFQFDATVPEAGDFVFTWYDDDGSVYTEQKSIAIG