Protein Info for HP15_1194 in Marinobacter adhaerens HP15

Annotation: DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00580: UvrD-helicase" amino acids 16 to 110 (95 residues), 55.8 bits, see alignment E=1.5e-18 amino acids 130 to 219 (90 residues), 62 bits, see alignment E=1.9e-20 PF13245: AAA_19" amino acids 28 to 202 (175 residues), 53.6 bits, see alignment E=6.9e-18 PF13361: UvrD_C" amino acids 225 to 377 (153 residues), 39.5 bits, see alignment E=1.3e-13 amino acids 439 to 520 (82 residues), 58.4 bits, see alignment E=2.3e-19 PF13538: UvrD_C_2" amino acids 467 to 517 (51 residues), 37.8 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: None (inferred from 67% identity to rpi:Rpic_3174)

Predicted SEED Role

"ATP-dependent DNA helicase pcrA (EC 3.6.1.-)" in subsystem DNA repair, bacterial UvrD and related helicases (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHJ3 at UniProt or InterPro

Protein Sequence (554 amino acids)

>HP15_1194 DNA helicase (Marinobacter adhaerens HP15)
MISVAEWKPADNLTLEPNAQKAATEQIHSLALTAGPGAGKTEMLAQRADFLLRSGTCTYP
KRILAISFKVDASQNLRERVKKRCGYDLASRFDSYTFHAFAKRIIDRFRPVLEGNDALDV
GFTIGDQKVPRKQITFVDLVPLAIQILKTSSIARNAVRQTYSDVFLDEFQDCTHQQYELV
KLAFHNTPVRLTAVGDVKQKIMGWAGALEGIFLTFAQDFSAMPLNLYRNFRSVPGLLRVQ
NEIIKVIDPDSVMPDEQLEGDAGEILSTQFANSSDEASYLADTIKSWIETEELAPSEIAI
LVSKQLDLYAHDLIKALTARGIPFRNEQEMQDITVEPAARLIVDYLSCLYGKREPKAWIR
LMKQLQPFADDDVQSEVSRSLDSFIRKQRKAMAGQTAEQRSTEWWEPAKLFLQHVGIETV
AALSPEYESKARLRDVITDTKNRISELSQSTSTLEEALDRFSDDESVRILTIHKSKGLEF
DSVIMMAIENEIFFGNQDENRCAFFVGVSRAKRRLVLTNAKLRPRPENHGGMWREHRSPQ
SEYLSYVEPFLTEH