Protein Info for Psest_1250 in Pseudomonas stutzeri RCH2

Annotation: iron-sulfur cluster assembly transcription factor IscR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 223.8 bits, see alignment E=5.5e-71 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 160.9 bits, see alignment E=1.4e-51 PF02082: Rrf2" amino acids 3 to 131 (129 residues), 136.7 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 82% identical to YOR2_AZOVI: Putative HTH-type transcriptional regulator ORF2 from Azotobacter vinelandii

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 97% identity to psa:PST_3043)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGD4 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Psest_1250 iron-sulfur cluster assembly transcription factor IscR (Pseudomonas stutzeri RCH2)
MRLTTKGRYAVTAMLDLALHAQHGPVSLADISERQGISLSYLEQLFAKLRRSSLVTSVRG
PGGGYQLSRDMAGIQVAQVIDAVNESVDATRCQGLGGCHSGDTCLTHHLWCDLSQQIHEF
LSGISLADLVKRQDVQQVALRQDMRKAGGTSPQMDKIETSAIE