Protein Info for Psest_1244 in Pseudomonas stutzeri RCH2

Annotation: protein-export membrane protein, SecD/SecF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 460 to 480 (21 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details amino acids 513 to 535 (23 residues), see Phobius details amino acids 556 to 578 (23 residues), see Phobius details amino acids 585 to 611 (27 residues), see Phobius details PF13721: SecD-TM1" amino acids 2 to 106 (105 residues), 106.4 bits, see alignment E=3e-34 PF07549: Sec_GG" amino acids 118 to 142 (25 residues), 25.2 bits, see alignment (E = 2.8e-09) TIGR01129: protein-export membrane protein SecD" amino acids 126 to 608 (483 residues), 442.9 bits, see alignment E=1.2e-136 PF21760: SecD_1st" amino acids 232 to 290 (59 residues), 98.6 bits, see alignment 3.3e-32 PF22599: SecDF_P1_head" amino acids 300 to 439 (140 residues), 109.9 bits, see alignment E=1.9e-35 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 347 to 601 (255 residues), 233.6 bits, see alignment E=2.4e-73 PF02355: SecD_SecF_C" amino acids 445 to 609 (165 residues), 64.5 bits, see alignment E=2.7e-21 PF03176: MMPL" amino acids 472 to 601 (130 residues), 27 bits, see alignment E=6.5e-10

Best Hits

Swiss-Prot: 78% identical to SECD_PSEAE: Protein translocase subunit SecD (secD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 97% identity to psa:PST_3049)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ36 at UniProt or InterPro

Protein Sequence (622 amino acids)

>Psest_1244 protein-export membrane protein, SecD/SecF family (Pseudomonas stutzeri RCH2)
MLNRFPLWKYLLILAVLAIAFVYSAPNLYPDDPAIQVTGASTAQEIGTEDLERISKALVD
GGIAVKSASLDEQGRGGLVRLERQDDQLPAKDIVRRTLGDAYVVALNLAPTTPDWLRSLG
ASPMKLGLDLSGGVHFLLEVDMEKAIETRLNVSEGEVKSLLRKERVRYRSLPNLKDAVQL
GFADEATLGNAQSLIRKNFTDFELTSSERNGQFVLRLTLTEAKLAEIREYSIKQNLTTVR
NRVNELGVAEPLVQRQGANRIVVELPGVQDTAEAKRILGKTANLEFRLAADADASRASTE
AFEFRQEGRPPVQLERTLIITGDQVTDAQASYDENGRPQVNIRLDGHGGDLMNRATRNNV
GRSMAVIFIEQRPMTRYVRQMVDGVEQEVRVETFQEEKKIISLATIQSPLGSQFRITGLD
GQGESSELALLLRAGGLAAPMYFAEERTIGPSLGAENIKLGVQAAMWGFLFVAIFMVLIY
KFFGVLATIALLFNMVVLTAMMSMLNATLTLPGIAGIVLTMGMAVDANVLIFSRIREEIA
NGMSIQRAIHEGFDRAFSAIVDGNLTTLLVGGILFAMGTGPIKGFAVTLSIGILTSMFTA
IIVTRGMVNLIYGGRDLKKLWI