Protein Info for Psest_1241 in Pseudomonas stutzeri RCH2

Annotation: S-adenosylmethionine:tRNA ribosyltransferase-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 1 to 337 (337 residues), 487.1 bits, see alignment E=1.3e-150 PF02547: Queuosine_synth" amino acids 4 to 336 (333 residues), 459.5 bits, see alignment E=3e-142

Best Hits

Swiss-Prot: 84% identical to QUEA_AZOVD: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 91% identity to psa:PST_3052)

MetaCyc: 66% identical to tRNA preQ134 S-adenosylmethionine ribosyltransferase-isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-1342 [EC: 2.4.99.17]

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 2.4.99.17 or 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKF8 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Psest_1241 S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Pseudomonas stutzeri RCH2)
MQVADFFFQLPDALIARHPLAERRASRLLVLDGETGKLSHRHFADLLEYVRPGDLMVFNN
TRVIPARLFGQKATGGKLEILVERVLGSRSVLAHIRSSKSPKAGSRILLDGGGEAEMVAR
HDALFELQFDEDVLSLLERIGHMPLPSYIDRPDDAEDRERYQTVYAQRAGAVAAPTAGLH
FDEALLDSLREAGVETAYVTLHVGAGTFQPVRVERIEEHHMHREWLEVTQEVVDAVAACR
ARGGRVIAVGTTSVRSLETAARGGELKPFSGDTDIFIYPGKTFHVVDALVTNFHLPESTL
LMLVSAFAGYPETMAAYAEAVAQRYRFFSYGDAMFITRNPVPRGPEESQ