Protein Info for HP15_1179 in Marinobacter adhaerens HP15

Annotation: lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00215: lipid-A-disaccharide synthase
  • amino acids 14 to 386 (373 residues), 400.9 bits, E=2.5e-124
• PF02684: LpxB
  • amino acids 18 to 383 (366 residues), 384.8 bits, E=2e-119

Best Hits

Swiss-Prot: 58% identical to LPXB_HAHCH: Lipid-A-disaccharide synthase (lpxB) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 84% identity to maq:Maqu_2535)

MetaCyc: 49% identical to lipid A disaccharide synthase (Escherichia coli K-12 substr. MG1655)
Lipid-A-disaccharide synthase. [EC: 2.4.1.182]

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

See E4PH07 at UniProt or InterPro

Protein Sequence (393 amino acids)

>HP15_1179 lipid-A-disaccharide synthase (Marinobacter adhaerens HP15)
MTDLSNATISERKITFGIIAGEASGDILGAGLIRSLRQRYPQARFVGIGGEEMVAEGFHS
LVPMERLSVMGLVEVLGRIRELFSIRARLLDYFFATPPDVVIGIDSPDFTLAIERRCREA
GILSVHYVSPSVWAWRQKRIFKIAKSVNLMLTLFPFEARFYEEHQVPVAFVGHPLADRIP
MAPDTLKMRESLGIDADAPVLAVLPGSRAGEVERLGTLFLEASRWIQERRPDLQLVIPCV
NRDREKQVRDLVDALEVKLPVTIVRGRSRDVMAASDVVLLASGTATLEAMLLKKPMVVGY
RLSGFSYALLSKLVKVPHVALPNLLAKRQLVPELLQDDATAESLGAAVLERLENKEERAR
LNEAFTELHHSLKQGADEKAAQAISDLIEQGAH