Protein Info for HP15_1174 in Marinobacter adhaerens HP15

Annotation: outer membrane protein, bacterial surface antigen family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 12 to 757 (746 residues), 866.9 bits, see alignment E=6.9e-265 PF07244: POTRA" amino acids 81 to 160 (80 residues), 48.2 bits, see alignment E=2.9e-16 amino acids 165 to 251 (87 residues), 53.3 bits, see alignment E=7.3e-18 amino acids 254 to 331 (78 residues), 59.5 bits, see alignment E=8.7e-20 amino acids 335 to 407 (73 residues), 51.8 bits, see alignment E=2.2e-17 PF01103: Omp85" amino acids 435 to 757 (323 residues), 284.6 bits, see alignment E=2.8e-88

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 88% identity to maq:Maqu_2540)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH02 at UniProt or InterPro

Protein Sequence (757 amino acids)

>HP15_1174 outer membrane protein, bacterial surface antigen family (Marinobacter adhaerens HP15)
MSGLKPALADQFTVADIEVEGLQRVSAGTVFSAFPVNIGEQVDETELAGAIKSLFRTGLF
TDIEASRDAGVLILTVRERPSISDIEIEGNKNIETEMLMDALAGAGLQEGQVFRRATLER
LELEILRSYIAQGRYNARVKATAEELPRNRVAIRLDINEGSVAAIHHINLIGNKDFSDEE
LQELFELQSTSWWNSLTNSDKYARERLSGDLESLRSFYLDRGYLDFNVESSQVSISPDKQ
KVFIAIALNEGPQYTISEINLRGDLIVGEEELRALIPVEEGDVFSRSRMTAISESLAFRL
GREGYAFANVNAVPEPGENNTAAVTFFVEPGKRAYVRRINFDGNVSTRDDVLRQEMTQME
GGVASSDRIEFSKTKLERLGFFQTVNVETVPVPGTDDLVDVNYSVEEQPTGSLSASVGFS
QDSGVILGANVSENNFFGTGKRVSFGVNVSDSIKSANISYLDPYYTVDGVSRGFSVFARE
TDYEEEDISSFLLDEYGGRVTFGYPTDSITRLNFGAGITQSNLKEGLFTSQEVSEFIDEE
GDSFTNFFLFGSWRRSTLNRGVLPTDGYSHSLSLDVAVPGSDLTFYKATHKTDFYYPVTD
DNRWVFRARSEIGYGDGYGDRSQMPFYEHFYTGGYGSVRGYEANSLGLRATNNVNDLSDP
DPFGGNLLTEGGLELIFPTPFAGDTRSMRTAFFLDAGQVFDTARGFDPELNEIRMAAGVG
FQWITAVGPLAFSLAYPLNDKAGDDTQVFQFSLGQTF