Protein Info for HP15_1171 in Marinobacter adhaerens HP15

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 80% identity to maq:Maqu_2543)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
phosphatidylglycerol biosynthesis I (6/6 steps found)
phosphatidylglycerol biosynthesis II (6/6 steps found)
CDP-diacylglycerol biosynthesis I (4/4 steps found)
CDP-diacylglycerol biosynthesis II (4/4 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
CDP-diacylglycerol biosynthesis III (3/5 steps found)
type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)
superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGZ9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>HP15_1171 phosphatidate cytidylyltransferase (Marinobacter adhaerens HP15)
MLKTRIITALILAPIAIGGIFFLPPLGFALFTGAIITLGAWEWANMSGIESPAGRVGYAL
ATAIILYGLLNVPFVAVLWLSLLWWGVCFLLVRGYPAGSEKWGSLPARAVMGLFVLVPAW
VGLNHLRTGGFQFGDSTNNLLLILYVFCVVWVADIGAYFAGRAFGKAKLAPRVSPGKSWA
GVWGGLMAVGVFALVVSWLASAGTVQTSLLILASLATGLVSVLGDLLESMLKRHRGIKDS
SQLLPGHGGIMDRIDSLTAAIPVFALIITKLGWLTTGHW