Protein Info for PGA1_c12080 in Phaeobacter inhibens DSM 17395

Annotation: putative acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 PF02771: Acyl-CoA_dh_N" amino acids 79 to 156 (78 residues), 56.2 bits, see alignment E=1.1e-18 PF02770: Acyl-CoA_dh_M" amino acids 161 to 269 (109 residues), 51.8 bits, see alignment E=1.8e-17 PF00441: Acyl-CoA_dh_1" amino acids 281 to 444 (164 residues), 65.9 bits, see alignment E=1.1e-21 PF22924: ACOX_C_alpha1" amino acids 289 to 441 (153 residues), 30.9 bits, see alignment E=5.7e-11 PF12806: Acyl-CoA_dh_C" amino acids 461 to 588 (128 residues), 132.1 bits, see alignment E=3.2e-42

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 88% identity to sit:TM1040_1557)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYE4 at UniProt or InterPro

Protein Sequence (593 amino acids)

>PGA1_c12080 putative acyl-CoA dehydrogenase (Phaeobacter inhibens DSM 17395)
MPSYTAPIKDTQFILHNVLKISQSGIPGYDELDADFTNAVLEEAGKISSEVLHPLNTVGD
IEGCRLENGVVYTPTGFKAAFEQVKEGGWTGLDMPEQYGGQNMPYVMGTAVGEMFSAANQ
AFTMYQGLTHGAASAILAHGTDAQKDTYLPKMVSCEWTGTMNLTEPHCGTDLGLMRTKAE
PQDDGSYKITGQKIFISSGDHDMADNIIHLVLAKIPGGPDGIKGVSLFIVPKFIVKDGGS
LGDRNGVSVGKIEEKMGIHGNSTCVMNYDSATGYLLGTEHKGMRAMFTMMNEARLGVGMQ
GLAQAEAAYQNALEYAKDRLQGRDVTGVKNPDGPADPLIVHPDIRRNLMDQKSFAEGARA
FILWGAKMIDQAHRAEDKDADGLISLLTPVIKGFLTDQGYDMTVQAQQIYGGHGYIEEWG
MSQYTRDARIAMIYEGANGVQALDLVGRKLAQDGGKHVMAFFEMVKNFCKENGDISEGYS
KEFIEPLKAASKDLQAAGMYFMQNGMTNPNNALSGSYDFMHMFGHVCLGLMWAEMAKAAQ
AELDAGSSDAAFYETKIATGRYYMARQLPATALHLSRIQTGGDTVMALAADQF