Protein Info for HP15_1168 in Marinobacter adhaerens HP15

Annotation: uridylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02075: UMP kinase
  • amino acids 11 to 242 (232 residues), 325.8 bits, E=7.6e-102
• PF00696: AA_kinase
  • amino acids 12 to 221 (210 residues), 96.4 bits, E=1.2e-31

Best Hits

Swiss-Prot: 96% identical to PYRH_MARHV: Uridylate kinase (pyrH) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 96% identity to maq:Maqu_2546)

MetaCyc: 66% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

See E4PGZ6 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_1168 uridylate kinase (Marinobacter adhaerens HP15)
MPTSSKTQPRYKRVLLKLSGEALMGEHDFGIDPKVLDRMALEIGALIGIGVQVGLVIGGG
NLFRGAALNAAGMDRVTGDHMGMLATVMNGLAMRDALERSNIRTRVMSAIPMSGIVEHYD
RRRAVRDLKDGDVVIFCAGTGNPFFTTDSAACLRGIEIEADAVLKATKVDGVYSADPHLD
SSAEKYDYLTYDEVLDKKLGVMDLTAICLARDHGMPLRVFDMNRAGALTRIVTGEKEGTL
IE