Protein Info for Psest_1223 in Pseudomonas stutzeri RCH2
Annotation: 1,4-dihydroxy-2-naphthoate octaprenyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 78% identity to psa:PST_3069)Predicted SEED Role
"UbiA prenyltransferase"
MetaCyc Pathways
- superpathway of chorismate metabolism (44/59 steps found)
- menaquinol-10 biosynthesis (2/2 steps found)
- menaquinol-11 biosynthesis (2/2 steps found)
- menaquinol-12 biosynthesis (2/2 steps found)
- menaquinol-13 biosynthesis (2/2 steps found)
- menaquinol-7 biosynthesis (2/2 steps found)
- demethylmenaquinol-4 biosynthesis (1/1 steps found)
- demethylmenaquinol-6 biosynthesis I (1/1 steps found)
- demethylmenaquinol-8 biosynthesis I (1/1 steps found)
- demethylmenaquinol-9 biosynthesis (1/1 steps found)
- superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
- superpathway of menaquinol-10 biosynthesis (4/10 steps found)
- superpathway of menaquinol-11 biosynthesis (4/10 steps found)
- superpathway of menaquinol-12 biosynthesis (4/10 steps found)
- superpathway of menaquinol-13 biosynthesis (4/10 steps found)
- superpathway of menaquinol-6 biosynthesis (4/10 steps found)
- superpathway of menaquinol-7 biosynthesis (4/10 steps found)
- superpathway of menaquinol-9 biosynthesis (4/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (3/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.- or 2.5.1.74
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GJ17 at UniProt or InterPro
Protein Sequence (299 amino acids)
>Psest_1223 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Pseudomonas stutzeri RCH2) MSGTLDWLGVARGRFLLLTLSCVALGLALAARGSAEAMSYSDALLVMLGALAAHVAVNAL NEWGDYRSGLDLQTRRTAFSGGSGTLVTHPHLLGRTLLLGLGSLLTCALIGLFFLLRQPP LLLSLAPIGLAGLLLVLLYTPWLTRHPWLCLFAPGLGFALMVLGTRIVLGGAPDLGDLWL ILPPLLLCNNLLLLGQFPDIDADRAVGRRTLPMHIGCANAVCVALAQWLLAYGVLLAVLA QPGLAGGALGLLTLPLALRAAWLLRREPLQAQRLLPALGLNAAVSVATPLLMAVGLLAL