Protein Info for Psest_1219 in Pseudomonas stutzeri RCH2

Annotation: Glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF13417: GST_N_3" amino acids 6 to 79 (74 residues), 53.4 bits, see alignment E=6.8e-18 PF13409: GST_N_2" amino acids 11 to 75 (65 residues), 44.4 bits, see alignment E=5.3e-15 PF14497: GST_C_3" amino acids 153 to 217 (65 residues), 34.8 bits, see alignment E=4.2e-12 PF13410: GST_C_2" amino acids 158 to 215 (58 residues), 40.4 bits, see alignment E=6.6e-14 PF00043: GST_C" amino acids 168 to 217 (50 residues), 25 bits, see alignment 4.7e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_3073)

Predicted SEED Role

"Probable glutathione s-transferase protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGA6 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Psest_1219 Glutathione S-transferase (Pseudomonas stutzeri RCH2)
MHELILHHYPTSPFAEKARLMLGFKQLSWRSVMIPPVMPKPDLTALTGGYRRTPVLQVGA
DIYCDTALIARRLEAEKATPALFPEGQEFAAATLAKWADSVLFLNAVSLVFQPESMAVRF
AQVPKEFVQTFSKDRAQLFANGSVSRVPLEQAKNDWPTFMGRLQQQLAREEGEFLLGAAP
SIADFAVAHCLWFLRATPVTAPLVDAYPEVSAWLAKVLGVGHGSSSELSAEDALRMALEA
EPAALPDDAFAEPNGFHEGQQVAIAAVDYGADPVEGELVFAGLEELILRRSDDRVGVAHV
HFPRVGYRIDAR