Protein Info for Psest_1217 in Pseudomonas stutzeri RCH2

Annotation: Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 266 (224 residues), 59.9 bits, see alignment E=2.2e-20 PF01464: SLT" amino acids 292 to 400 (109 residues), 80 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 95% identical to MLTF_PSEU5: Membrane-bound lytic murein transglycosylase F (mltF) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 96% identity to psa:PST_3075)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GID4 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psest_1217 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein (Pseudomonas stutzeri RCH2)
MFAQTVFRKRCAIWLLATGLFLMLSSCAEKPSELERIQEEGVLRVITRNSPSTYFQDRNG
EAGFEYELVKRFASNLGVELQIETADNIEEIFSRLNRPGGPALAAAGLVASEGRMELARF
TRSYLDVTTQVVYRSGQRRPTNPQDLIGKRILVLKGSSQAEKLASLQAEYPELRYEESDA
VEVVDLLRMVDEGQIDLTLVESNEMSMNQVYFTNIRAGFDVGEQNSLAWIVAKGEDDSLL
KAADAFLEQAQQNGTLQRLRERYYGHVDVLGYVGAYAFAKHLQQRLPRYEKAFRETAKQH
GIDWRLLAAIGYQESHWQPEATSKTGVRGLMMLTLRTANAMGVTNRLDPVQSIQGGGKYL
VKIHTGLPESIEEPDRTWFALAAYNVGGGHLEDARKLAEAEGLDPNKWLDVKQMLPRLSQ
KQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQMEGQQLAKSDLHIPGIYATDLM
EELPPL