Protein Info for Psest_1215 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00106: adh_short" amino acids 3 to 125 (123 residues), 60.5 bits, see alignment E=2.4e-20 PF13460: NAD_binding_10" amino acids 9 to 87 (79 residues), 27.6 bits, see alignment E=3.9e-10 PF13561: adh_short_C2" amino acids 9 to 123 (115 residues), 46.9 bits, see alignment E=4.2e-16

Best Hits

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKD5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Psest_1215 Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) (Pseudomonas stutzeri RCH2)
MQKTVLIVGASRGLGLGLAKQFSSAGWQVIATVRDPQHADTLRQIPQLRVETLDMDDAAS
VDQLAGRLAGTRLDVLFVNAGVAGPQNKPATQATQAEVGQLFYTNAVAPLRLAEQLLPLV
ETDQGFVCDRLNSVPDSRLLPLARPWQPL