Protein Info for HP15_1159 in Marinobacter adhaerens HP15

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 9 to 376 (368 residues), 551 bits, see alignment E=6.2e-170 PF01546: Peptidase_M20" amino acids 66 to 373 (308 residues), 154.1 bits, see alignment E=4.8e-49 PF07687: M20_dimer" amino acids 179 to 285 (107 residues), 94.3 bits, see alignment E=4.3e-31

Best Hits

Swiss-Prot: 92% identical to DAPE_MARHV: Succinyl-diaminopimelate desuccinylase (dapE) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 92% identity to maq:Maqu_2554)

MetaCyc: 61% identical to succinyl-diaminopimelate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinyl-diaminopimelate desuccinylase. [EC: 3.5.1.18]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGY7 at UniProt or InterPro

Protein Sequence (378 amino acids)

>HP15_1159 succinyl-diaminopimelate desuccinylase (Marinobacter adhaerens HP15)
MQTTDSPTLELAVDLIRRPSVTPDDAGCQELMMSRLAPLGFTGENLRFGDTDNLWARKGS
EGPVLAFAGHTDVVPTGPEKNWSHPPFDPVIRDGYLLGRGAADMKGSLAAFVTACERFVA
SYPDHRGSIALLITSDEEGPAQHGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNG
RRGSLHGYLTVHGVQGHVAYPHLAENPVHLVAPALDALAKEFWDNGNDFFPPTTFQITKL
EAGTGSNIIPGECLVHFNFRYCTENTAESLEERVVAILDRHNLKYDLQWHLSGRPFLTDK
GALVSASQSAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDECVKAD
DLNTLSEIYEQILIELLA