Protein Info for Psest_1213 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02608: Bmp" amino acids 35 to 300 (266 residues), 194.3 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 55% identical to PBP_BRUA2: Purine-binding protein BAB2_0673 (BAB2_0673) from Brucella abortus (strain 2308)

KEGG orthology group: None (inferred from 84% identity to pmk:MDS_4017)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ10 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psest_1213 Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein (Pseudomonas stutzeri RCH2)
MQNNTRKTLLRALAAAIGFSAALTTAAASAADPLKVGFVYIGPIGDHGWTYQHEQGRKYM
EEKLGDKVKTSFVENVPEGADAERVIRNMAKSDYDLIFTTSFGYMNPTLKVAKQFPKVTF
EHATGYKQAKNVGTYLTRSYEGRYVGGFLAAKMTKTKKIGYIASFPIPEVIRDINSIQLA
LDKYNPGTEIKVVWVNTWFDPGKEADAANALIDQGVDVIFQHTDSPAPIQAAERRGVYSV
GYASDMQHFGPKAVLTSIVNDWGPHYTKSAEAVMAGTWKSEDFWGGLAQDSISLPISDLV
PADVKTEAEAIIASIKSGDFHPFTGPIKDQAGEVRIAEGETASIKDLASMNYYVEGVKAE
MPK