Protein Info for Psest_0118 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 91 to 118 (28 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details PF07681: DoxX" amino acids 33 to 119 (87 residues), 66.6 bits, see alignment E=2.5e-22 PF04173: DoxD" amino acids 82 to 150 (69 residues), 25.7 bits, see alignment E=9.9e-10

Best Hits

KEGG orthology group: None (inferred from 80% identity to ppw:PputW619_2188)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFC9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Psest_0118 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MNVMHNLPLRLRQQWNGVAQRMQQLLGDSLLHLLARLAIAAIFLLSGRTKVSGVLDITPG
TFELFRSEYALPLLPPPFAAHLATYAEHLFPLLLVLGLFTRLSALALLLMTLVIQLFVYP
DAWSTHLSWAALLLLLIGRGAGRLSLDHLLGIR