Protein Info for Psest_1206 in Pseudomonas stutzeri RCH2

Annotation: ABC-type Mn2+/Zn2+ transport systems, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 175 to 217 (43 residues), see Phobius details amino acids 224 to 251 (28 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details PF00950: ABC-3" amino acids 13 to 270 (258 residues), 170.7 bits, see alignment E=2.3e-54

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 91% identity to psa:PST_3085)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK42 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psest_1206 ABC-type Mn2+/Zn2+ transport systems, permease components (Pseudomonas stutzeri RCH2)
MTPDLLWAPFGEFAFMRRALFGGVALACSAGPLGVFLILRRMSLIGDAIAHGILPGAALA
FWLFGLSLPALTAGGLVAGLGMAGAAAWVTRRTGLREDASLAALYPISLASGVLLLGLAG
RKLDLLHLLFGSALAVDTPTLYGMLGTALFSLVVLALSYRALTLDSLDPLFLRSISRFGP
LAHAAFLTLVVLNLVIGFQAIGALMVVGLMMLPAAAARFWSRRLLILLPLAALIGALCVW
LGLVLSFYASLPSGPCIVLLAGVFYLFSLVAGPVNGLLRSTTFPITV