Protein Info for Psest_1200 in Pseudomonas stutzeri RCH2

Annotation: putative urate catabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_3093)

Predicted SEED Role

"Uricase (urate oxidase) (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

ureide biosynthesis (5/7 steps found)
urate conversion to allantoin I (2/3 steps found)
superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKB9 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psest_1200 putative urate catabolism protein (Pseudomonas stutzeri RCH2)
MTADYPRDLIGYASNPPHPHWPGDARIALSFVLNYEEGGERCVLHGDKESEAFLSEMVAA
QPLQGVRHMSMESLYEYGSRAGVWRLLKLFDQHAIPLTIFAVAMAAQRHPELIQAMASAG
HEICSHGYRWIDYQHMDESEEREHMQEAIRILTELTGERPLGWYTGRTGPNTRRLVREEG
GFLYDSDTYDDDLPYWDPESTPEKPHLVIPYTLDTNDMRFTQVQGFNTGDDFFTYLKDAF
DVLYAEGCEGAPKMLSIGMHCRLLGRPARLASLARFLEYVKGFDKVWCARRVDIARHWHA
THPLTAERNA