Protein Info for HP15_1144 in Marinobacter adhaerens HP15

Annotation: protein belonging to uncharacterized protein family UPF0061

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF02696: SelO" amino acids 9 to 453 (445 residues), 454.3 bits, see alignment E=2.5e-140

Best Hits

Swiss-Prot: 52% identical to SELO_ALIF1: Protein adenylyltransferase SelO (selO) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K08997, hypothetical protein (inferred from 82% identity to maq:Maqu_2569)

MetaCyc: 47% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGX2 at UniProt or InterPro

Protein Sequence (484 amino acids)

>HP15_1144 protein belonging to uncharacterized protein family UPF0061 (Marinobacter adhaerens HP15)
MSGNDFRIEHRYLELPDSFYTRVQPSPLKDAKMVCFNHKLAEQMGFRADSESEWTGVGAG
SELLEGMEPVAMKYTGHQFGAYNPDLGDGRGLLLWETVGPDGRRWDWHLKGAGMTPYSRF
GDGRAVLRSTIREYLCSEAMHGLGIPTTRALFMVSAKDPVRRESIETAATLVRVAQSHIR
FGHFEFAAHHEGPESVKTLLEHVISLHSPHLINLPDDDRYARWFEEVVERTARTIADWQA
VGFCHGVMNSDNMSIIGDTFDYGPFAFLDDFDAGYISNHTDQGGRYAYNRQPQVGFENCR
YLATALLPVMEEDDVRRGLRRYEVAYNERFLQNMRDKLGLAIEDEADLSLIMDTFSMMHE
HHVDYTAFFRALSNLHSHGPGPVRDLFVDRSVADQWLERYEERLLNESRAHDEREYAMRR
VNPKYVLRNYLAQQVIQEAQNGDYEPMKALLKVLERPYDEQPENEAYAALPPDWGKHLNI
SCSS