Protein Info for Psest_1199 in Pseudomonas stutzeri RCH2

Annotation: OHCU decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF09349: OHCU_decarbox" amino acids 11 to 169 (159 residues), 171.3 bits, see alignment E=1.1e-54 TIGR03164: OHCU decarboxylase" amino acids 13 to 171 (159 residues), 228 bits, see alignment E=2.9e-72

Best Hits

Swiss-Prot: 39% identical to URAD_HALJB: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HacjB3_16066) from Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3)

KEGG orthology group: None (inferred from 98% identity to psa:PST_3094)

Predicted SEED Role

"2-oxo-4-hydroxy-4-carboxy--5-ureidoimidazoline (OHCU) decarboxylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG85 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Psest_1199 OHCU decarboxylase (Pseudomonas stutzeri RCH2)
MTPFKTIKPSTLDRDAFVAAFADVYEHSPWVAETVYGAGADETLDYVEVMHTRLSQAMLA
ADHDTQLALVNAHPDLAGKAAVRGELTAASTSEQAGAGIHECTAEEFARFTELNDAYKAK
FGFPFIMAVKGSNRHQILAAFEERIHNDPEREFARALAEINKIALFRLQAM