Protein Info for Psest_1198 in Pseudomonas stutzeri RCH2

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02961: allantoicase
  • amino acids 10 to 328 (319 residues), 473 bits, E=1.8e-146
• PF03561: Allantoicase
  • amino acids 20 to 165 (146 residues), 162.5 bits, E=3.4e-52
  • amino acids 187 to 329 (143 residues), 174.1 bits, E=8.9e-56

Best Hits

Swiss-Prot: 94% identical to ALLC_PSEU5: Probable allantoicase (alc) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 94% identity to psa:PST_3095)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

• superpathway of allantoin degradation in yeast (5/6 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (1/2 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)
• superpathway of purines degradation in plants (11/18 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Sequence Analysis Tools

See L0GIZ8 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psest_1198 allantoicase (Pseudomonas stutzeri RCH2)
MKAYAAPFEKYVNLADARLGTRAISVTDDWFADVNRLFQPTPAVWKEGVFDDNGKWMDGW
ESRRKRFEGYDHAVIRLGVPGQIKGVDIDTSFFTGNYPPSASLETCYITDGEPSDDTVWS
EILPAVELKGNSHHYHEIAFDQPVSHLRFNIYPDGGVARLRVHGIPYRDWSSVGDNQQID
LAAALNGGRALACSDEHFGRMSNILNPNRGENMGDGWETARRRTPGNDWVIVALGHPGEI
ERIVVDTLHFKGNYPDSCSIQAAYVKGGTDSQIETQSLFWRELLPSQKLSMHAEHEFAEQ
IARLGPITHVRLNIFPDGGVSRLRLFGKVAR