Protein Info for Psest_1197 in Pseudomonas stutzeri RCH2

Annotation: Ureidoglycolate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF04115: Ureidogly_lyase" amino acids 1 to 158 (158 residues), 202.6 bits, see alignment E=1.6e-64

Best Hits

Swiss-Prot: 95% identical to ALLA_PSEU5: Ureidoglycolate lyase (allA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 95% identity to psa:PST_3096)

MetaCyc: 53% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIB3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Psest_1197 Ureidoglycolate hydrolase (Pseudomonas stutzeri RCH2)
MRTLKIEPLTKEAFAPFGDVIETEGSDYFMINNGSTRRYHKLATVETAQPEDQAIISIFA
ADALEMPLAIRMLERHPQGSQAFIPLLGNPFLVVVAPLGDAPVPGHVRAFRSNGRQGVNY
HRGVWHHPVLTIEKRDEFLVVDRSGSGNNCDEYFFTEDQQLLLDPQRKST