Protein Info for PGA1_c01180 in Phaeobacter inhibens DSM 17395

Annotation: Predicted P-loop-containing kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF03668: RapZ-like_N" amino acids 15 to 165 (151 residues), 135.8 bits, see alignment E=1.1e-43 PF22740: PapZ_C" amino acids 172 to 291 (120 residues), 154.9 bits, see alignment E=1e-49

Best Hits

Swiss-Prot: 73% identical to Y2438_RUEST: Nucleotide-binding protein TM1040_2438 (TM1040_2438) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 73% identity to sit:TM1040_2438)

Predicted SEED Role

"ATP-binding protein ManX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWQ2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>PGA1_c01180 Predicted P-loop-containing kinase (Phaeobacter inhibens DSM 17395)
MRDPDIACDPTAVPIVLVTGPSGAGRTTAINVLEDLGFEAIDNLPLRLLPGLVDANSLTR
PMALGLDSRNRDFSPAALLDVIDMLSARRDLDLTVLYLDADREVLLRRYSETRRRHPLAP
AEDPEVGVLREIDLMLPIRDRADLLLDTSELNIHQLKADIERRFAPGGRSLAVSLQSFSY
KRGVPRSIDMVFDCRFLRNPYWEQSLRSLDGRDVAVQSYVREDSRYEPFFDRVLDLIRLL
LPAYREEGKSHLSIAFGCTGGQHRSVTLAETLAKDLAEDGQQVSIRHRELHSPRQK