Protein Info for HP15_1135 in Marinobacter adhaerens HP15

Annotation: DNA recombination protein RmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF02646: RmuC" amino acids 153 to 450 (298 residues), 369.1 bits, see alignment E=7.1e-115

Best Hits

Swiss-Prot: 42% identical to RMUC_ECO57: DNA recombination protein RmuC (rmuC) from Escherichia coli O157:H7

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 84% identity to maq:Maqu_2040)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGW3 at UniProt or InterPro

Protein Sequence (491 amino acids)

>HP15_1135 DNA recombination protein RmuC (Marinobacter adhaerens HP15)
MPEAIMEQMLSRPDLMAALMVVLILLVVLKGLRGRNGRLEQDVEHWRQHAASLENRLAGL
ESELESRKERFAQVESERQTLRAKAEELSEALGEARMSLREQEVTIDKERRSASEKLELL
ERNRDALKQEFENLANKIFEQKSERFSQQTRTSLDTLLNPFRDQLQDFRKRVEDVYTNET
RDRQALRSEIKSLQDLNRQITEEAANLTRALKGDKKIQGNWGELILERVLEKSGLRKGVE
YDTQGSYRDSDNQLYRPDVIVHLPDNRNLIIDSKVSLVAYQQWVTEDEDSVVREEALKQH
VEAVRNHIRTLSEKDYSQLHGLHSPDFVLLFMPIEPAFVAAFQQDENLFAEAFERKIIVV
TPTTLLATLRTIENIWRYERQSQNARRIAERAGAVYDKLRVFVEAMERLGTQLHTAQGTY
DSAMNTLTRGRGNLISQANRFVELGVRVKKELPKGIMDQAEVDDSDEFLHSGDDDRPDSE
EQAIGADNEQE