Protein Info for Psest_1188 in Pseudomonas stutzeri RCH2

Annotation: FOG: EAL domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF13185: GAF_2" amino acids 33 to 169 (137 residues), 43.5 bits, see alignment E=5.7e-15 PF01590: GAF" amino acids 34 to 166 (133 residues), 33.2 bits, see alignment E=1e-11 PF00563: EAL" amino acids 191 to 406 (216 residues), 171.6 bits, see alignment E=2.9e-54

Best Hits

KEGG orthology group: None (inferred from 84% identity to psa:PST_3107)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIZ1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Psest_1188 FOG: EAL domain (Pseudomonas stutzeri RCH2)
MLAHLQSATAITRDDPVAILARLEAGSMPIGSMLCEALHAVRSHLGMEVAFIAEFSEGAR
IFRHVDGRTERLTLCVGDSNPLEDSYCQRVVDGRLPELIHDAAQLAEALLLPVTTELPVG
AHLSVPIRFSDGALYGTFCCFSTRSDGSLNDRDLNTLRLFAAFAGRLLETQAKSQQARQT
QQNRVAAVLAKRAYGVVYQPIVHLVENRIVGHEALARFTDEPVRSPDKWFADAGQVGLQQ
ELEIALIEAALQGFDLLPADSYLSLNVSPETILAGAVAEVLSEQPLDRLMLEVTEHALVE
DYERLADALRPLRSRGLRLAVDDAGAGYASFRHILKLKPDVIKLDSSLIRNVDSDMGCRA
LAAALIRFAEETGCKVVAEGVETHEELAMLRRLEVNKAQGYLLGRPMPLRRRAATG