Protein Info for Psest_1170 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 223 to 382 (160 residues), 146.3 bits, see alignment E=3.6e-47 PF00990: GGDEF" amino acids 225 to 379 (155 residues), 130 bits, see alignment E=3.6e-42

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_3126)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK91 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Psest_1170 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MPAFLDLLRDRLSSLLPSELKPNELRHLLSPRRHPLLLCQRRATLIVNRVRLFAFLFAVL
TPLWSLIDLMVFEPKLWAALAGFRMMACLAFTCLLLFYRPSGNLLDAYRAIAILFAIPTI
FYIASHTLLGSYQLAQFSAVVGAGYAFLPFVLMAGLTIFPLTLVENLVLSSLLLLAQALA
GYLSWATLNWPSFAGAFWLLILIAGVASLASMSQLAFMFALVRQAIRDPLTGVFSRGSGE
EILRLQWDSAQRKNGALALAFIDLDHFKTINDNHGHEAGDQVLREAARRLVAALRASDSL
LRWGGEEFLLIMPDTDMLQARQALERIVGQGLGQRPDGAALTASIGLAERRCDQVADYRD
LLELADKRMYRAKTSGRNRLCVMEPEALEQGTFVLGA