Protein Info for PGA1_c11500 in Phaeobacter inhibens DSM 17395

Annotation: putative pyridoxal-phosphate-dependent aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 61 to 78 (18 residues), see Phobius details amino acids 91 to 102 (12 residues), see Phobius details PF00155: Aminotran_1_2" amino acids 15 to 169 (155 residues), 34.8 bits, see alignment E=1.1e-12 PF01041: DegT_DnrJ_EryC1" amino acids 46 to 391 (346 residues), 205 bits, see alignment E=2.1e-64

Best Hits

KEGG orthology group: None (inferred from 84% identity to sil:SPO1295)

Predicted SEED Role

"DegT/DnrJ/EryC1/StrS aminotransferase family enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZJ7 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PGA1_c11500 putative pyridoxal-phosphate-dependent aminotransferase (Phaeobacter inhibens DSM 17395)
MSQTSPSQVPNVHQAEPIPEAARTALEALMQSGDLFRYTAPQDAPVALLEEEFAQLLGSK
YALAVSSCSAALFLSLKALDLPRDARVLIPGFTFAAVPSAIVHADCVPVLCEVGANYRID
MADFEAKLNDVQAVIISHMRGHTSDMDAIMALCQARDIPVIEDAAHSLGTTWHGRNIGTL
GAIGCFSFQSYKMINAGEGGILVTDDADLVARAVIMSGAYEHNWKKHKSAPGDNTCDLEQ
AFAKWQNQLPLYNLRMSNLSAVVIRPQLPELARRVRDGLKNHDYVADQLNRSPHIDVPAP
LAPEQRAPDSIQFNLVDMSHDEITRFAAATEARGVKVQIFGRSADNARAFWNWQFLRDIP
ELPQTRAMLMQACDVRLPVRLTRDELDVIAGILLSAMDDTMGAAAA