Protein Info for Psest_1165 in Pseudomonas stutzeri RCH2

Annotation: Lysine efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details PF01810: LysE" amino acids 18 to 200 (183 residues), 139.3 bits, see alignment E=5.7e-45

Best Hits

Swiss-Prot: 46% identical to ARGO_PECAS: Arginine exporter protein ArgO (argO) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 96% identity to psa:PST_3131)

Predicted SEED Role

"Lysine efflux permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK86 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psest_1165 Lysine efflux permease (Pseudomonas stutzeri RCH2)
MNAIWQSYINGLLVAAGLIMAIGAQNAFVLAQSLRREHHLPVAALCIVCDVLLVSVGVFG
LAAVLASNPLLLEITRWGGVAFLVWYGTLALRRAAKPQSLRSADAQPRPLRAVLLAALAV
TLLNPHVYLDTVVLIGSLGAQQPEPGAYTLGAASASTLWFMTLALGGAWLAPWLARPLTW
RLIDLGVAAMMFAIATQLAFAG