Protein Info for Psest_1164 in Pseudomonas stutzeri RCH2

Annotation: Superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF00081: Sod_Fe_N" amino acids 3 to 82 (80 residues), 115.1 bits, see alignment E=1.7e-37 PF02777: Sod_Fe_C" amino acids 89 to 190 (102 residues), 137.6 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 88% identical to SODF_PSEAE: Superoxide dismutase [Fe] (sodB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 98% identity to psa:PST_3132)

MetaCyc: 72% identical to superoxide dismutase (Fe) (Burkholderia sp. AK-5)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG54 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Psest_1164 Superoxide dismutase (Pseudomonas stutzeri RCH2)
MAFELPPLPYEKNALEPHMSAETLEFHHDKHHAAYVTNLNNLIPGTEFEGKDLESIIKTS
SGGIFNNAAQVWNHTFFWNCLAPNAGGQPTGALAEAINASFGSFDKFKEEFTKTAIGTFG
SGWAWLVKKSDGSLGLASTIGAGNPMTAGDKPLLTCDVWEHAYYIDYRNARPKFVEAFWN
LVNWDFVAKNFAG