Protein Info for HP15_1108 in Marinobacter adhaerens HP15

Annotation: 3-ketoacyl-(acyl-carrier-protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 10 to 190 (181 residues), 157.4 bits, see alignment E=4.9e-50 PF08659: KR" amino acids 11 to 166 (156 residues), 23.8 bits, see alignment E=5.6e-09 PF13561: adh_short_C2" amino acids 15 to 259 (245 residues), 152.4 bits, see alignment E=2.4e-48

Best Hits

Swiss-Prot: 61% identical to XYLL_PSEPU: 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (xylL) from Pseudomonas putida

KEGG orthology group: K05783, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase [EC: 1.3.1.25] (inferred from 67% identity to mme:Marme_1558)

MetaCyc: 63% identical to 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase subunit (Ralstonia eutropha JMP222)
1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase. [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]

Predicted SEED Role

"1,2-dihydroxycyclohexa-3,5-diene-1-carboxylate dehydrogenase (EC 1.3.1.25)" in subsystem Benzoate degradation or Phenylpropionate Degradation (EC 1.3.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGD0 at UniProt or InterPro

Protein Sequence (261 amino acids)

>HP15_1108 3-ketoacyl-(acyl-carrier-protein) reductase (Marinobacter adhaerens HP15)
MRFDRFENCVAVVTGAAQGIGRSVALQMAAEKASLLLVDRSEIVKEVAEEALVAGAATVQ
TIVVDLEQYAGACQAVDAAVSHFGRIDILVNNVGGTIWVQPYEVYNEEQIEAEIRRSLFP
TLWCSHAVLTQMQKQESGVIVNVSSLATRSTNRVPYAAAKGGVNAMTVCMAFENAKYGIR
INAVAPGGTDIGERRIPRNSKPMSQLEKEWYQSIVDEATELSFMKRYSAPEEQANAILFL
ASDEASYITGTVLSVGGGYQG