Protein Info for HP15_1108 in Marinobacter adhaerens HP15

Annotation: 3-ketoacyl-(acyl-carrier-protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 190 (181 residues), 157.4 bits, E=4.9e-50
• PF08659: KR
  • amino acids 11 to 166 (156 residues), 23.8 bits, E=5.6e-09
• PF13561: adh_short_C2
  • amino acids 15 to 259 (245 residues), 152.4 bits, E=2.4e-48

Best Hits

Swiss-Prot: 61% identical to XYLL_PSEPU: 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (xylL) from Pseudomonas putida

KEGG orthology group: K05783, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase [EC: 1.3.1.25] (inferred from 67% identity to mme:Marme_1558)

MetaCyc: 63% identical to 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase subunit (Ralstonia eutropha JMP222)
1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase. [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]; 1.3.1.- [EC: 1.3.1.25]

Predicted SEED Role

"1,2-dihydroxycyclohexa-3,5-diene-1-carboxylate dehydrogenase (EC 1.3.1.25)" in subsystem Benzoate degradation or Phenylpropionate Degradation (EC 1.3.1.25)

MetaCyc Pathways

• meta cleavage pathway of aromatic compounds (9/10 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• 3-chlorobenzoate degradation I (via chlorocatechol) (2/4 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.25

Sequence Analysis Tools

See E4PGD0 at UniProt or InterPro

Protein Sequence (261 amino acids)

>HP15_1108 3-ketoacyl-(acyl-carrier-protein) reductase (Marinobacter adhaerens HP15)
MRFDRFENCVAVVTGAAQGIGRSVALQMAAEKASLLLVDRSEIVKEVAEEALVAGAATVQ
TIVVDLEQYAGACQAVDAAVSHFGRIDILVNNVGGTIWVQPYEVYNEEQIEAEIRRSLFP
TLWCSHAVLTQMQKQESGVIVNVSSLATRSTNRVPYAAAKGGVNAMTVCMAFENAKYGIR
INAVAPGGTDIGERRIPRNSKPMSQLEKEWYQSIVDEATELSFMKRYSAPEEQANAILFL
ASDEASYITGTVLSVGGGYQG