Protein Info for HP15_1106 in Marinobacter adhaerens HP15

Annotation: Rieske (2Fe-2S) domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 8 to 91 (84 residues), 79.7 bits, E=1.3e-26
• PF00848: Ring_hydroxyl_A
  • amino acids 158 to 340 (183 residues), 66.9 bits, E=2.4e-22

Best Hits

Swiss-Prot: 60% identical to BENA_ACIAD: Benzoate 1,2-dioxygenase subunit alpha (benA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 68% identity to mme:Marme_1561)

MetaCyc: 58% identical to XylX (Pseudomonas putida mt-2)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• meta cleavage pathway of aromatic compounds (9/10 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See E4PGC8 at UniProt or InterPro

Protein Sequence (414 amino acids)

>HP15_1106 Rieske (2Fe-2S) domain protein (Marinobacter adhaerens HP15)
MKYIFEGNWVYLAHESQIQENNDFFTTYIGRHPIIITRDKSGNLNAFLNICTHRGAMLCR
SKKGNKSVMTCPFHGWSFNNSGKLVKVKDEKGSGYPDSFNCEGELNLKNIAKFDSYRGFL
FGSLNSDVQDLNDYLGDTTKIIDMIVDQSEDEIEVLRGASTYTFDGNWKVQAENGVDGYH
VSAVHWNYVATVARRKQGLSEDSAKSVDLSSWNKQKGGSYAFKNGHTLLWMEAPNPQDRP
LAEKREELSRKYGKNRADWMISNIRNLGIYPNVFLMDQTSTQIRHFRPISVNKTEVTIYC
FAPKNESGEARNRRIRQYEDFFNATGMATPDDLEQFNSSQISFHASKAPWNDLSRGAKHW
IDGQDKEAESIDIFPLLSGVKSEDEGLFVMQHECWANALLRGMSDEEDKVICKE