Protein Info for Psest_0112 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00126: HTH_1" amino acids 9 to 63 (55 residues), 44.3 bits, see alignment E=1.4e-15 PF03466: LysR_substrate" amino acids 96 to 297 (202 residues), 127.3 bits, see alignment E=5.8e-41

Best Hits

KEGG orthology group: K13928, LysR family transcriptional regulator, malonate utilization transcriptional regulator (inferred from 99% identity to psa:PST_4109)

Predicted SEED Role

"Malonate utilization transcriptional regulator" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH23 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_0112 Transcriptional regulator (Pseudomonas stutzeri RCH2)
MQIDEELTLKKLEVFLAFMRSGNLGKAAVELNTSNVSVHRAIHSLESALRCPLFKHEGRS
LIPLESAYVLEERAQQLVKDVLETVRQTREAAGFSAERFKLGALYSLTVKTVPQLIMGLK
LRRSELNIDLILGSNVDLLYKLKNMELDAILVSLNESVADPDCAQVQLFSDDIFLAAPAD
SPFANQSEVDLSDLRDATFITLSQGFATHQDGNRVFQLAGFEPKVAMQVNDIFTLLSMVN
SGVGYALLPGRVGMVYESRVRLIPLQARYHLQQHIGVVFLKAKERDPNLLALLAECRMYS
LKHPS