Protein Info for HP15_1097 in Marinobacter adhaerens HP15

Annotation: branched-chain amino acid ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00005: ABC_tran" amino acids 22 to 178 (157 residues), 104.1 bits, see alignment E=1.5e-33 PF12399: BCA_ABC_TP_C" amino acids 229 to 249 (21 residues), 29.1 bits, see alignment (E = 8.8e-11)

Best Hits

Swiss-Prot: 34% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 69% identity to mme:Marme_1566)

MetaCyc: 32% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Benzoate transport, ATPase component" in subsystem Benzoate transport and degradation cluster

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGB9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>HP15_1097 branched-chain amino acid ABC transporter, ATP-binding protein (Marinobacter adhaerens HP15)
MANEIILETESLSKHWGGIKALDDISLQFQDKHLHGVVGPNGAGKSTLLNMLCGTLKPTS
GCIFHKGDQIEGMKPWEFVHRGIGRSFQKTNIYVDVTCLENCAIAAQRRFTGSFNLFASR
HSNKLVREGAEKALCQVGLENRVHTVAAEISYGEQRQLELAMVLATDPCILLLDEPMAGM
GHEESQRIIELMNQLKQTYSIVLVEHDMDAIFELSDQLTVLDNGTHLITGTVDEVRNDTR
VKEAYLGKEKEEEAA