Protein Info for PGA1_c11290 in Phaeobacter inhibens DSM 17395

Annotation: putative holdfast attachment protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 PF00005: ABC_tran" amino acids 16 to 140 (125 residues), 81.9 bits, see alignment E=2.7e-26 amino acids 291 to 432 (142 residues), 89.9 bits, see alignment E=9.5e-29 PF16326: ABC_tran_CTD" amino acids 523 to 591 (69 residues), 71 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 48% identical to HFAC_CAUVC: Holdfast attachment protein C (hfaC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 86% identity to sit:TM1040_0920)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKW0 at UniProt or InterPro

Protein Sequence (595 amino acids)

>PGA1_c11290 putative holdfast attachment protein C (Phaeobacter inhibens DSM 17395)
MSGISLTFGGDPVFADLDLVVQPGDRVALVGRNGSGKSTLMKVMAGLVEADKGSLVVPPG
KSVGYMEQDPQMTGFATLGDFAASELDPGEMYKVERAGEGLKFDPARPVATASGGEKRRA
ALAKLMAEAPDLMLLDEPTNHLDIEAITWLENELKSTRAAFVLISHDRAFLRALTRATLW
VDRGQVRRQEKGFDAFEAWRDKIWEEEDQQRHKLNRLIKSESRWAVEGISARRKRNMGRV
RALQDLKSERSSQIKRQGTAELALDAGPKSGRKVIEAEGLMKSYGDKAIVRDFSIKVQRG
DRVAFVGPNGAGKTTLLKMLLGLEQPDEGHVQMGTNLELALFDQTRDQLDGNASLWENLT
SDPLLGISGKADQVMVRGQPKHVVGYLKEFLFDEAQARAPVRSLSGGEKARLLLARLMAR
QSNLLVLDEPTNDLDVETLDLLQELLDSYDGTVLLVSHDRDFLDRVATTTIAMEGGGGAT
AYAGGWSDYLAQRAPAEGAAEKAEKAKAAKPKPKQEAQPKDGLSFKEKHRLEALPGEIER
LEAEIAKLQQLMADPELFTREPVKFQKATDALVERQEKLSAAEEEWLELEEKSAG