Protein Info for PGA1_c01130 in Phaeobacter inhibens DSM 17395

Annotation: putative cation efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 11 to 288 (278 residues), 218 bits, see alignment E=8e-69 PF01545: Cation_efflux" amino acids 13 to 205 (193 residues), 137.4 bits, see alignment E=5.5e-44 PF16916: ZT_dimer" amino acids 210 to 287 (78 residues), 82 bits, see alignment E=2.8e-27

Best Hits

KEGG orthology group: None (inferred from 63% identity to sit:TM1040_2446)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWP7 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PGA1_c01130 putative cation efflux pump (Phaeobacter inhibens DSM 17395)
MAKRMSAEQLATTSIAVALLVLCAKALAWWLTGSIALFSDAMESLVNIGGAIIAWFAVRY
ASRPADAGHPFGHHKAEYFSAVVEGIMIIVAALLILQEAISALLVPTPLVWSAAGLWVNA
GAMVINLLWARVLIARGAALKSPALAAGGRHLMSDVWTSAGVLIGLVLAMGTGWSLLDPV
LALLVAVNILREGYLVVASSVGGLMDQAAPQNERDEIAAIIHRTAQGALQVHGLKTRRAG
QAVFVEFHMVVAGDMTVRASHAICDRIEEAIRVALPTAQVTIHVEPEHKLEDSGIKPGQ