Protein Info for PGA1_c11230 in Phaeobacter inhibens DSM 17395

Annotation: integration host factor subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF18291: HU-HIG" amino acids 3 to 96 (94 residues), 29.1 bits, see alignment E=9.3e-11 TIGR00987: integration host factor, alpha subunit" amino acids 5 to 98 (94 residues), 163.6 bits, see alignment E=5.9e-53 PF00216: Bac_DNA_binding" amino acids 6 to 94 (89 residues), 96.1 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 96% identical to IHFA_RUEST: Integration host factor subunit alpha (ihfA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 91% identity to dsh:Dshi_1721)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DP70 at UniProt or InterPro

Protein Sequence (100 amino acids)

>PGA1_c11230 integration host factor subunit alpha (Phaeobacter inhibens DSM 17395)
MGEKTLTRMDLSEAVFREVGLSRNESAQLVESLLQHMSDALVRGEQVKISSFGTFSVRDK
SARVGRNPKTGEEVPIQPRRVLTFRPSHLMKDRVADGNRK