Protein Info for Psest_1139 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 signal peptide" amino acids 16 to 19 (4 residues), see Phobius details transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details PF00672: HAMP" amino acids 185 to 234 (50 residues), 38.5 bits, see alignment 2.9e-13 TIGR00229: PAS domain S-box protein" amino acids 287 to 403 (117 residues), 29.9 bits, see alignment E=2.6e-11 PF00989: PAS" amino acids 289 to 394 (106 residues), 40 bits, see alignment E=9.2e-14 PF08448: PAS_4" amino acids 294 to 397 (104 residues), 40.1 bits, see alignment E=9.4e-14 PF00512: HisKA" amino acids 414 to 462 (49 residues), 29.4 bits, see alignment 1.7e-10 PF02518: HATPase_c" amino acids 554 to 663 (110 residues), 86.2 bits, see alignment E=5.3e-28

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_3156)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG34 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Psest_1139 PAS domain S-box (Pseudomonas stutzeri RCH2)
MILRQRLENLPVGRKLLLALLVLLAAVLLISNLTFISAAYWISRQSVAPQAMHTLGELFA
TEELSTRALSSPEAANALLKRLEGYAPLRAAVIYDGHGNSLAQLQQGERLRLPEQLGAVA
QWRAGEIRANLLVRLPQPDGSAGHLLMVASSELPGAFYTGTLTASLAILVASLLLWLLVA
RQIRQLITRPIRDLEALSRQVTREEDYSLRAKPGNQDEIGRLADAFNTMLSRMEAREQQL
KRARDDAQEAFDHAQGLAEETRHSNRKLELEVQVRSKIEQKLTGFQKYLNSIIDSMPSAL
IALDEQLYVTQWNQEASALSGTPLDDALNQPVFVAFEPLKPFLAQIRRTSEQHVVAKIER
VTWLRNDEPHHYALTCYPLTGAGGRGVVIRIDDITQRINMEEMMVQSEKMLSVGSLAAGM
AHEINNPLGAILHNAQNIRRRLSPELERNREAAEETGVRLEAVNQYLQRREVPQLLDGIQ
QAGSRAAKIVSHMLSFSRMSNRQLADCHLPVLIDQALEIAGNDFALMEGFDFKAIDIVRD
FDPRVDRVPCIGNELEQVLLNLLKNAAQAIHAHQVGEPGQIILRTRLNPPWAEIQVEDNG
GGIPENVRKRIFEPFFTTKEVGQGTGLGLSVSYFIITNNHQGQMEVQCQPGHGTTFTLRL
PLNSPAEPAAT