Protein Info for Psest_1138 in Pseudomonas stutzeri RCH2

Annotation: ATP:cob(I)alamin adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF01923: Cob_adeno_trans" amino acids 8 to 173 (166 residues), 191.2 bits, see alignment E=7.5e-61 TIGR00636: ATP:cob(I)alamin adenosyltransferase" amino acids 9 to 186 (178 residues), 166 bits, see alignment E=3.2e-53

Best Hits

Swiss-Prot: 46% identical to PDUO_BACSU: Corrinoid adenosyltransferase (yvqK) from Bacillus subtilis (strain 168)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 92% identity to psa:PST_3157)

Predicted SEED Role

"ATP:Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIU2 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Psest_1138 ATP:cob(I)alamin adenosyltransferase (Pseudomonas stutzeri RCH2)
MGNRLSKIYTRTGDAGETGLGDGRRVPKDHPRVEAMGEVDTLNSQLGLLLAELAEAQVQW
PALDELISVLAPCQHRLFDLGGELAMPDYQALQESEIERLEQAIDRWNAELGPLKEFILP
GGSRLIALAHLCRSMTRTAERRCQLLNASEAVRPVLLAYLNRLSDALFVAARLIARRQGC
GEILWQPAAAKPQANG