Protein Info for PGA1_c11200 in Phaeobacter inhibens DSM 17395

Annotation: putative deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF06559: DCD_N" amino acids 13 to 174 (162 residues), 238.5 bits, see alignment E=5.4e-75 PF22769: DCD" amino acids 15 to 173 (159 residues), 127 bits, see alignment E=1.1e-40 amino acids 178 to 339 (162 residues), 110.6 bits, see alignment E=1.3e-35 PF22569: DCD_C" amino acids 179 to 366 (188 residues), 293.4 bits, see alignment E=8.5e-92

Best Hits

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 73% identity to dsh:Dshi_1723)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZH0 at UniProt or InterPro

Protein Sequence (369 amino acids)

>PGA1_c11200 putative deoxycytidine triphosphate deaminase (Phaeobacter inhibens DSM 17395)
MTSEGQTSSSLTQGVLSDRQIRQMITGAAIAASSPILNDQIQPASLDLRLSDCAYRVRAS
FLPGLGRTVAERLEDLTMHRVALTGGAVLEKGCVYVVPLMERIRLPEGMTAAASAKSSIG
RLDVMTRVITDQGVEFDRVPDGYDGPLYAEICPQSFSVVVQPGQLLTQIIFRQGRTFLSD
ADLRAVHEATPIVSGDPVISDGLGFSVDLRPERGDLVGYRAKHHTGVVDLSKLGHYDPAE
YWEEVRTTKGQIILDPGAFYILVSREAIAIPPDYAAEMAPYLAMVGEFRVHYAGFFDPGF
GYAAAGGAGSRGVLEVRCHDAPFVLEHGQVVGRLVYEKMSEVPEQLYGVDIASNYQGQGL
KLSKHFKTS