Protein Info for HP15_1080 in Marinobacter adhaerens HP15

Annotation: transcriptional Regulator, Crp/Fnr family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00027: cNMP_binding" amino acids 30 to 117 (88 residues), 46.5 bits, see alignment E=4.3e-16 PF13545: HTH_Crp_2" amino acids 151 to 204 (54 residues), 39.8 bits, see alignment E=5.3e-14 PF00325: Crp" amino acids 165 to 194 (30 residues), 29 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 76% identity to maq:Maqu_2052)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGA2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>HP15_1080 transcriptional Regulator, Crp/Fnr family protein (Marinobacter adhaerens HP15)
MEKLTLQHSILETLPESLRRDALNGLQAIQFEHGKVLFRAGDPCQGLPLVLHGSVKVQMT
GLSGNSIVLYRMGADDICTLSIGCLMTGDGFRAEAVVEEDAKVLMVPRGLFDRLMDQSAD
FRLGIMESYGRRLNDLMLLVEEVAFRRMDERLLHWLEARAGQRAITITHQELAIELGTAR
EVVSRLLKELERKGRLRLARGKIEFTGSFAE